PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA10G0079800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bHLH
Protein Properties Length: 91aa    MW: 9964.33 Da    PI: 8.5297
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA10G0079800.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH192.6e-0620581654
                       HHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                HLH 16 iNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                       i +  ++L+ llP+a   ++ ++  a +L++++ YI+sL
  ORGLA10G0079800.1 20 IGDLVSKLQALLPEARLRSNDRVPSARVLQETCSYIRSL 58
                       5667799*******8899*******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.102.4E-7474IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.194458IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474599.42E-9680IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MSSRSRSRAS SAARITDEQI GDLVSKLQAL LPEARLRSND RVPSARVLQE TCSYIRSLHR  60
EVDDLSERLA ELLAAADVST AQAAVIRGLL M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8365891e-153CT836589.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA333Z79, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614007.16e-56PREDICTED: transcription factor ILI7
SwissprotA2Z7301e-58ILI7_ORYSI; Transcription factor ILI7
TrEMBLA0A0D3HDG18e-57A0A0D3HDG1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GN298e-57A0A0E0GN29_ORYNI; Uncharacterized protein
TrEMBLI1QUB58e-57I1QUB5_ORYGL; Uncharacterized protein
STRINGBGIOSGA032878-PA2e-56(Oryza sativa Indica Group)
STRINGORGLA10G0079800.12e-56(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.15e-18bHLH family protein